@2( fg@H$$H$HpJ$H$J  J$`H`V`AVH2$ BH (I(`H$J  @{$J  @{{$J $ H $ H`$J  LH IJ$ @$'&@J HPa>$```````hhhhhh01234577<=>?89:;`<<$HxI`$H @lqh`J  @{$J  @{{$J $BCZRR2 J#h LYZb@02~2< H >IA!H@<HX> {H2$$$H2$$$I @0AJRANNJK JLH(I`H I JI0R0R20J `4w4THPH`H` 1o7fl 2@|U]x@T0UUx 1!3"2 00@UEx -!/". ,0@U5x )!+"* (0@V%x %!'"&@DVx !" 0@lVx@wf4@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@`1o4fl@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@`1o4fl@AHIf1ON2 xI\ 2"          /.    &qp10>B"2.6* &@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@`1o2fl`N0o3fl@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@0`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@8`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@@`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@H`o9fl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@P`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@X`ofl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@``o7fl&l:9>=<;'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@h`ofl&l:9>=<;'&l&524130#"! &lw&l@{0d@;0@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@o0fl&l:9>=<;'&l&524130#"! &lw&l@{0d@;0@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g{|}~yz@o0fl&l:9>=<;'&l&524130#"! &lw&lJ PIJ YH#J P1HboPc @CxJ 80P0H'8CQ`h``3J aH#J8CC 1H@VsC $J P0H8 2 l` 1KL80 O0a0H dJ APlSIM!lJh  l)hL"lJ $PJ$H @8J$I a\n$"l$@8L$8`$`$`I P 2J ZQ 2oI H 0L2ZPH cTg cTg `( (   0 8 J  J ` J / J `/`L cRUR!P`Ng`  2`R0NP+CK08 `F0XR0x` J J R2JQ >RJPJ 8R` `2A 2K coC0L2[`HTT"HJP 2APDѼ0JJ @ J |Ha2PDS2BlQ ` ¬ʼ` 2ZPH PJ Q ȼ 20J@Zs ᬢѼ 20J @Zg  NO 2J ` @ZXVXN ƺ * !҇e$ `  [ T Ƣd T Ɗ w T #~ r |P@AP2Q  `@XVQ2X QHcT ʬ¼ȼ  0"0Yd` ` cAU! 2J 큐ZЬPP2BlЬPAcAT!80dM ƽ - !Յe' `  [ #T ƥ n $T! ƍ w T "~ g u |P@AP2Ь cAAT)R{`  A2P:0dP2ClXAcTjR|`!  2!20JJZڼEӼPZ@0@d! ۼ 2ZPJP/  NO"22 `@HVZHP ƺ + !҃e% `  [ #T Ƣ n $T! Ɗ w T !~ r |AP22ZQJ  `@PVPQ2 QHcT ʬ¼ȼ0 dHM `@A G T cU O T 'd0Q702Ԭ caATRx`  a2Td`T T2Bl/0 2`T oJg/ OA   &d O T >0/@CT@/YcUnR{` D 2J dQ8  PƠgO0-8 0}C0pP #2CvJ PD07PJPR 28 L d0 RP8`CT ` @`RP#2D0xP P`M`ORQ0-2y BJ 8P!DA08PJC`y`  `c- 0cgAT 2XIVXx`Z,h TC0@d:J J < J @ cPThR{` 2%20JPbZJB0I.Ѽ 2.20JJZȼ2I ڼeѼPZ 2ZPJPѼD0b.` 00_@` 0x` `0Yd` ` cU0dP (0B 20 o$QCgUgL0Ry` 7P8D0Rc`TR02P2JIPJP`IV`0'2c`T Ry`  2JZP`I V`B0@dD0@d `!HPaM aO0 J80@ ^9 2h4 D 22coPTZT g a ` L2`T2``J2 !l `PH aBlAl`PHAl`Q2HP D0`(D0 800`g! 02c`o\L0U 0Yd ` cU"2J  ZHA 0L2ZPH7 cT0rPd2!RJI ZPXI Vk0X!Ѽ h`D0H2c2cDaAT@ [HPPP0dR0g aᬢl0 ѼEd*` 222Cl@`B2 lP !a@ Bl`Cl@lP@Cl@lH2S2@XHP 00-2!RJIZP`I  V` BQѼ qQ80g!aᬢD0 Ѽ@d)2` 22Cl@`B2 lP @ Bl`Cl@lP@Cl@lH2S2@XHPW 0@-S 0 (0w2XL2oZQHcTFQc2? 0g a 0` 2%2"22@2b2$l@`A2 lHP!aL2P2@ `!l"lDl@lPH@`@lDlH2T2@`HP 00,0- c2.0eRz` `2I V`DZ20JHZPJPA0@d 2I(V`ZPJPl0Ed cTrQ.02CN X@C 2I tJANg^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C2AN@lQ^AX: X@C 2J tJANg^AX/C20O X@C 2I tJÃg^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C 2AN^AXX@C2AN@lQ^X: X@C 2J tJÃg^X/0J RALOP2!2 Q2o WaJ0Oa2A `e 0```90 0@P`pк 2J^gd J09hJB"*Z8 `"l  d` "l: 0y`W2;89n :g :o89 2* `Z@^ 08 R  d8 2^R :Ph*9WZBn`!lZ8 AP:g :h2ZB ^^ l ld0 h82*WZ8*^82CZ8 0^`kh88:98e!89,! `89@d l 98: ?0 ?9Rg;0: "l Rd ;0`@ 298 ; l8L0B`b2;8B :B (9"!T 2DlL2`PD!l9A c89BO TV@MyC@OHW89H@O2t0ZT989:!lAPZ l9P9S0?P/k8 h9 X  gXdZx`٭IAT@`Zܭ AV*`` b;/` N@d! HF`W)hh&a:/`` 9X  gXdZ)HZܭCB`(W.`h"f8/`@OP`r JAh @W(``a`9k/``";ڭTa"X >8d%9 B0I0Rg BXR >R h8aJhQ yJ N^RR8 g88@h8WEd9:`TT NI     J D 0gTN hD@ASa/0d J DJ H J @z`*<Z*NR;P%[ ' a```` .8 E I9Q 0  Rg 8R 8>8K0:`D0f! 0Rg R  Rg R00 d8HRP99%Yf&>g; ;:: :090;3$898PyRQ98>`xR; Ra* 8`` :$.; g8;@hWEd89 d8HRPh9%Z h`  ?T`T` `(NHT HN`W&Q& PQ0"`b శh"htNgb$ 8 g98@h9WEd:J N^Q8`TJ^lNg`PN dH0  J N^R^` lhA 9h!lht@0o``2( o@W&c `K0BW& &h*hb  8 g:8@WEd`:8 `%dY> @0 J 4O^TO2bx`ZS  ⬊^T@ lUSj ` ^`?`, ;0g`( 8 g88@hWEd8: `%dX:JRP8D0K0:`%:P 2J 4O 0Q@^TP2R!0|@zSZ2P ` ` A CJ`W>%"d^H%⬊^IDgZ !l``؅!0TTPP24 SK0`g`2``7T"P8G0gI`pI@dJ 4 ᰤ9@082 ( ,c%йK0B98%^`}$K0PйK0L9%dY8HRP98D0K0c`$ZObй`1h簠ad8HRP9:%8Zb09"` f'B0I0Rg :RAJhQ #J N^RR  I` fMR9BPaR6"'\ 4 6 4g#r0Q0Sg 0R8`T0g PXrRP9 haJ!R0>2S@C2J 4OICJ^ 26J^ 4 2 lA4o0@g 4WCd` 0TO0P 2 :G@RH: 20!HG@Rx`TM2J 4O70F@^R 2 lA4o2@oJ4WCdp` 0TO0AP62 2!HF@R[x`AT4 20 lgA4o4@WCd0 J 4O2T^EQ2TQHP:R JR 22 dH2 l:20g l: RR 20 0:gH 8P8R: 0gH a/1H 2J 4O^T2OQP6/f0R8`T0KPJ Y \XJR4 1H 2J 4O^2TOQP 2 ?29G@RP9g( )H0R8`TJ0 tX PgXrRP9ka( 80P>08O@R,S" 0H` 8`T 00RHPgYJRP9aha:" \f'9B0I0Rg :R8  9`H`R. `@  p2g d@W`Gd8A0 J 4O^TOP2 F@SP1`m !H x`TP`@.1He)H9hA.@JhtXBc  { 2hg d@WGd:  2J 4O@S^NTP@hV@B  2g d@WGd`8 `'fYK A0 J 4O^TOP2!HF@S x`TP!`-1HP-CJ`\XfMRP8'\`T!   2hg d@WGd: `'fXMRP8D0K0:`F!  2J 4OS^NTP*hV@B:BR RI0AR9w :R8q  U;   Rg 8R @99K0:aD08b0!B0 :8Rg 8R:J  Rg 9R8 fMRP8'\` 99H:9Q9@:g l@`:g8@ `*/ L9Q"J  DZ0g : DZ0 999aK0:D08a0!A0 8Rg A0RQ   Rg I0R2 fMRP'\a+ 9`g9:,9a:D0K08!bQ098fMRP'\bD0K02 BhBfMRP8D0K0 `'\` fMRP9'\aD0K0c fMRP:'\bD0K0c 0]K0K0,K0`(`"Y 89d%8B0H0Rg :R `&>= 88lgg889``!:8:`D0K0=!bQ09d8;%KRXPbD0K0D F`&d8HRP89%XD08K0 ``, 9%dY8HRP98D0K0c` d8HRP998%Y`D0K0c8)`X  ڭR `: ;+ ڭF`hkP98 ڭR0PK0"dڭР ``:X XgXdZ٭O#`Z`ڭ>X DgXdZ٭OP(hZhڭP9X .gXdZ٭AOP`Z0`ڭ9X gXdZ٭PZڭQ-:` ` (`ڭA``Rc; c> c*ҹ3A 80**0p*8T^bootargs=root=/dev/mtdblock0 rwbootcmd=run rambootbootdelay=5baudrate=115200loads_echo=1ipaddr=192.168.0.15serverip=192.168.0.2autoload=norootpath=/romfsgatewayip=192.168.0.1netmask=255.255.255.0hostname=BF537ramargs=setenv bootargs root=/dev/mtdblock0 rwnfsargs=setenv bootargs root=/dev/nfs rw nfsroot=$(serverip):$(rootpath)addip=setenv bootargs $(bootargs) ip=$(ipaddr):$(serverip):$(gatewayip):$(netmask):$(hostname):eth0:offramboot=tftpboot 0x1000000 linux;run ramargs;run addip;bootelfnfsboot=tftpboot 0x1000000 linux;run nfsargs;run addip;bootelfflashboot= eeprom read 0x1000000 0x20000 0x100000;bootelf 0x1000000update=tftpboot 0x1000000 u-boot.ldr;eeprom write 0x1000000 0x0 $(filesize); cT2 2#x X$cT2 2#p P$hHL6$$F6`W6$$F(pHLL6$$F&W6$$F0cT2 2#h H$$fyPQRSqrptus1ONa ` aa `1a ``gH' 3540219&g-'/ g' g'/ g'/ #/o`flo`flo`fl #/   Lh MH$&@Q#`I    2M^ QP & d%I4H L% L1$%$Ac`P =II< l JH0!<   +2h_+P  <I J2$%$B```` L K%IB`BR#2^sI;IB`I@T ;J#` <I L$410 L%L0$%$@QhhЧR#2 T  K# /2ZQf0 #Q/`<<@A@0 ARN 20 ᬦJ I!< g  +2i_+P  <IvJ J2%$B`oM L '`(!g 'g$flpqrstuI>qONO#  M LeH 2`Z"h i-.$'I  gTWNWO2[ d$543210iJD2Io$xx$/oM L `(!qIT g 'g$flpqrstuIVqONO`HI $@<#I%`U O#  M LeH 2`Zh (@-WvJ.$'I I  gTWNWO2$K dJ$543210iJD2Io$hh$/fg@H$$H$HpJ$H$J  J$`H`V`AVH2$ BH (I(`H$ H $ H`$J  LH IJ$ @$'& 220 lP H 0 0 22 lP  g l` H 02  ` lRCB000 d2P Rp8010P20CQ0 g `000 dg9 2P R2h C lR  l lKC 2/@02 C  lR  lKC 2/A0 `p 1080 J  "00Q2P J ` 002A H `J Q00 2' 02B `b02A H Q2I lQC C A0 `2 g: 22 Hg: 0 2 22L 2 Hoz  ZQZ ooHoz D022 R  l lg `2  lg B0`000!0 (00 080 0 00 gd` 20 XCB0g g: `p 00 d 0805 `00cO32P```J 2`QT ` `J I3$J !T$J CIJ  xOH@PA?Bl3J $ AV$J CJ N3$J cT$J CJ N&IJ  OH@PA?Bl3$J 0`$J CJ `3J @Bl@"l@Bl@@o@l@"l>@"l@"l@"lB@"l@"l @"lF @"l @"l J !`#J CJ !#@XC 5 (Og```!20@ 0XB@aJTXB@L0XB@ YBD0t@YB@8J 2 ާ)0"0B|07d( 02`D0cA02`[ T!B0p` !0 ` 02`D0 J` p@[J @[kJ ާ@[`J @[UJ ާ@[JJ H` 6 `@ T " T )H(J  @[ J  J p @AxP2` =4 2J P^RRY) J t` J |`  A 'JI XxQ ( J t`J8 kL \ `DJ J R `b!bJ  !`U .L t" ,@ 0(\0s7gA"L\0 E@P\0w4J A\\0D@`\0d4xH  @[ @\ jH@ \7 @[7[HcBHC@OANVJ tP2J Qoal J P^80RdR`] L  !0 Q0A\d0A\8ddA0Z*`|D0Qd- J  dX  XA0d\d  XA0d\udC0SJ J7 J @yJ PL )J p@CƂ@C0BpA@\RCD@ @\!U6 b@G ]%62L pK @ ]6  J  2!JTT @8]5P`6J @LT] 6! @d]IO5 AHO@P`6J @l\5@\5A @LJ EJ `J ``b! Ha!JP J `@`2`J dQ`  @|]h5@]^5A DVJ 220K  J  ,B)`l0d1`  J(` 2oK` BJ  J dJ `OAP@]N5 0gQ`` a5 0!` @]4J  )`&`J J` J J J  @]4b J J [J A J J gJ {0HOPgQP 0d0J t r  %@^d4J ` `TBd@ ^ 0u4@$^K4BHC@OANVHTAOV!O@T@NVVx090 @8^ 0740g08"`oO0ad"`f0G0g"`ZJ t d@p^4I 0`"A"0اQ.0d22``L0``{!Q_Bl 2` $0@e0`e`0e`0e`0L02`e lA"PeQ2 2 c!Z2 l!SK2 l`l!``aa` /`mc.!OOAVAVGOLW x'`P 0L0"`meK0S)D'Q40"CcjAl @J !OP2 D:!C 6  2Y0g@CHC)`1`% !1`C0 dJ x @L0J @1d2`+*l[D0 @L0"J P @YJ0/*[D0AScc\2#lC0xQ s0d K0Qd. |L` a`-  1` i `<AaHi`_& J  J  R J /K0B0dFF G02P >@^+  X !` 0l * GP2P "@^!@ G2P @^a 2K00dT0x2`[ 2K0 !q``@^-2B P!nJ `# AB0^ q v @K0pdc2lG0gL0 .J t!` @|]1NA lJ | d@^1J Aا50tP 2 A`2` 0`a!` AD0@dD0Ap"`pdD0Ad2`T2`cd!` lJ RL2DI0B0dA )@ጐ@^R,2B P!n J `AB0^$ J |!` @|]0A HHTAOV!O@T@NVV@^0J `x80GP 2zaP d g 08x802`08x_080 P8J +8 '8 #8 ᣆJ᥆J 8J H` 8xJ L/c8C*ZAb02B050(080dcU`c2O 0dOhX\2a0H#lX`T#l #l  M2`^C0 000 dM2`S^Q2HJ2P!lBlHPB0@d`J (0d90"0 8 ``O8098`O8~0 8 O0 P 0:J IOQ*Zd0dJ00' 5 (O"o ᥆J J H J LJ PJ6 D@ x90`!1@0P`O`@``W0 5 q(O`fq8J XQoqJ P^RR᥆J ` ᣆJ` J 0*Z80C0 20U `T 0 dM2`^00D00d 7dM2 `^DB0M᥆J J H8 J  *ZB0z08RM᥆J!`0 J 05*Z80C0 2AaL0 `T $m 0 dM2`^00D050d 7dM2!`^DB0MᣆJ, J J *ZC0X 2A a 0 0``dmDD0MᣆJ1`S0 *[D05A80 aeD0SMᣆJ)`T0sJ @ `FJ D2KL @` +J p@CƂ@C0BpA@RC^\;A\@\E. D0aN 80 D0d20 d L0L GJ  W @_-J DL@ ] pK-   J  J !JTT @8]-J J @L$_ -! @d]IO- AHOK8J @8_-AL`v@,^J T`J X`J P @`2`J P(0"J XQoqJ P^RR᥆J 0J X`!ᣆ 0JJ X`!*[ 0D08=J &8 "8 8 8 J h@L0QdagJ X(`j!@\_ O0 P 0U8J +8 '8 #8 J h@Q`a@^,J @J @x_,J `[!*[ 0D0 8J -8 )8 %8 !8 @L0d aJ X1`J hQJ  @_e, *[ 0D08sJ D8 @8 <8 88 48X00ya Km A_0m80PL00Q2Z`Z L002Z`Z @_/O0 P"d 0k8J c 8 8 8 8  8C> L !EQOW @]+ !zW a,8J J Q80P!dMP0J t A`L J 8P0 0dJ X9h%  J @`J X!` L J  J XhQ 'A`L>/ @_+J PxI J `2A @_9+J Ƣ`T @a TPҁTa@!9ON@PPI02`B @_  +PҠS3s!9O80V!(0Va 0mV!09O0eVƈ!0^V`OWa0hVWJW  h 2G0AfPag`T/0 g0!dIV 0!BV   K `50 0!dd5V"^M'mS@Q!0UQQQ4P9`V!2!9O80U!9O000V!80U!0Ua80U`a0U"   S d`BT 'n#m bJ `PJ `  S dJ`d P!D0X`)0g 00"0edg0!dUS!0UQ o@a`U!m@QPQ`@xaQ@Q@A᱆ဿPP 2U)C X C0! @`)s!*[D0K0` `:-\!T2`C;ae0K Ca b#\  lQC :, J2 l`9,D0*Z`(0+r0`9.  gg8C#\ C:0 g= 0g $    2 {f 8C;aC"\ i #aC"\ `f 2oda 8CAaZ"{V2o#aC d M lq0ooG 8CJa#}DD0:.PRgh *ZZR0:.BZH 2l@0*WZZ`A0$2B  2 ldo QC C  8C9aC"\2od` ` <.`0 C d C 2`*WZh lHaJ` XD&*ZZQ l lH a I` /*Z^` zh`S @,``( *ZZ`C w& 2D @L`(c3 bS @p`!/J Q H@|``(/ J*Z򼹢S0D0a c ' ;-T;-<,aC  <- ` c0 2)020 2`$l @p` @`!>(` =#  0L8 $ld7` "2(00:80!3g 8`(0 d $ SFP00dg 2b@`0Z"P' d  @`(g  2b@` `Z"P' d  290;| `S05vg? J 0 4J J J cJ IH  `A  2*QZJ ZQJ `0S'` `hb(00S`Ck`P`8(J `SZQC  "D BL ![h/G0gCg0)g `s# P@C8 2J Q^RRO2oG0gZg!0@L0p dA00F/r`CC`  ;  3 M8 w )`N3`n1 ` s` Y``e ` !`U ` hk/@`'g `/J `c!Y0 SJ ZP'd+! E@`'g"!แ ;R00g 2GyP00 d@`0P&ae'`@`a'dD0o แ 90 aS'd็  @`K'0 g0 ṋ B@`YRP K.@`1'g  ` a#'d็  @`'0 g. GSgyP00 d=@`'@`0P#&a&@`g&> g໤.C`H @0g8 J J ARQ%+ I  $J PX0J d hLIAF J ^ 8`&V.@`&g  ` a&d็  @`&0 gG00m0 0'@QR`P%.G0g@0!CW0qg 0W .C a*L Ib ^A3 d` `#J ! J dJ J C0` J 00(090 0Mg`0 00>JQ QQ W @` L `R`C0 c `@` `R`-080@` (05 3@`0$` %` ` `%  '(d dg@a0$  T P`% 0`` l@a @Ad 50 @a f$8 @0a^$ `@80 J `/X@`l(0/`/P`6%/ `/HTAOV!O@T@NVV2@@aB2B ` P!n``10L "@K0D05 B'V@Ha `h80a`L0"@㗷8 @\a#`d @2Z 0K0`80@la/J 1`@|a/} 2D @a/d޲ 80/`&  K0T002`0Z'2 R``T0 R 0` L0 d l` `0α0x `O P``l.80@a0#0880@08b 0q#l@Hba@Tb@`b@hb!@tba@b@b#h  2@bad.#(` d/2Z@{0baKl#Zdr0/@b"`@b!#` 220z @p` "` `P`z0- 2@b'dL0"00gd 0``:8@$c"0HTAOV!O@T@NVV2(0B`!0>JC T @d( HTh AO`dP 2HZ l"HZ l2D0 HdL0 @dP"c: 0`BJgf Юc0ʻB 0@d Z:2L0etR@!`0ѻ0@dB"/2`(R0~`0[@zdcT2 2Q80T0@eea"O00f𰐹0pp@4e!@he!` 2J O0g `O0L @Ti:x  ,@iT @Llh AC H"`E 6  @i A4[ 0'fA0\\U,@P\0 J P29g!db`  @i I r`   ``k8:x3tm7 @C!`2P `8 *P0 7 0 5@O0g` O  O!0@|0007, @tz Q/`0y10`&0y10 `2QaP B0d``UB02x90QaP B0`d`A2 `B0`90`@gT800!0=Kc80 D009 ^VY \20(0000F800B8 000l0LJ Q^RR `@ N> ` ( 8 ` " 0080 0l0(J R^RR/` /`   /`` J ᤨSCl/@}0`2 ` @p``% !`3  0 0  ` a a`Q @~r` 2A )  B@~~ 0@~n ` 2 dA0dhB0"2802`A ~0"`I ` d! A~`; ` d @ 2J ᜫZH @ 0` O0A0g`zC `J  `f ` PL @@Q `"P""2@P e`l @\gy  cA@d~RC  @ A@~~@ J Ƞ`x -J ` 80"., A@@p0, 0, 0 5  `8p F_ VF J ` 80+ 005. 00~6  `0@K Y20< 80@8 g  ``` 0 \J `o 00Q+ A@)(@ 000+ 000j. 0004 00@ 00,0gA0d0^@P\0 @\ 00  `C0 `T#@1L Ta1J C02` P lP `TPaTJ` J @J J J 0 I JJJ @gJ `J DRRJ J J J J @J J J J J J J J J @J J L ! C 0$J CRb` J P` J R0RxJ < J IPhg 8 2 lV` DH2E00Ih`2`I` <J aJ A]@\2RkoDB `z B0gL !~  `l g a (`d 0g@Cg a0`V 90{2g  @8`F 20gg ha@`8 Jg  a H`) 0g!N P` ga X` g!N `` a a ~`e 2K ` oZe!Y`C0z0d+2e l[J HP `C0L `e!a N`D0dJe HP`D0L `e!a Y`D0dJe HP`D0  (c@Y:0<+ `O `` 89```8 "`R` ":8@9ԁPQ:&PHi`A  t@9:G0O0`ggһ +`` 8Q0 D000P $"0L00uQ4Q*[W0D0!gn 00 0@8Z`G0gA`8 0'@ 00P0zfA0x0@P\0~ !@|9:_J9 BJ DP@J J Hi`J <`J` IJ aJ J J J J @J J J hkJB J  /C%.T C/T g|CD0IJLHAKCBe   @ 2 22 2 22,CT02T HCyCPqCgwCg7 AQYCL0T o}CT0T hvCL0 T axCqCPP`TPaTeSg _qC@gxCQXCBQ+ VC0 T ?S0C"D0 "SH2J Jl ApCEQg *C T `TPaTe Ci`2 d0 2J J J J J J @J $2J C0Xc0 S0C S0o 0w!Bu$22.``  .d"d80&@P000 fAx00V@P\0 8L8 `@!ἂ ` @9 :"`89+@ P:㲙Pf `/::-J J S/0@4:0T2B PaJ ᬨ` J ᬨ` h :P``2@@+ c``p *O0 W0[Pgg  M gH K0Q0: D00 5 0L0@P> g7( )) 'LS@d00d7 00w0)%fA0\\0v@0P\X (0J ᬨ  d0!dQ7 pa *[2 J ᬨ80 8C{ 8C 0  , Q`i` *Z` DT2 'j@Q  l*WZ*Z `T2! D Oc`U _ d d> @̃\ ` @0S J `  zP``J J @ጅ. ` 2"0 @p` `- ```J Q``8000`㍞Q(00@ᤅ0g  ``2` :0< `O ``` 0 K  ``2 ` ``00 ` 2@B̅0 20 (P $2@L >0 ": @XL0 Q$l  C CC/P`\ ` 2902R #Zqae g  !s!d c c ` ` '`028 !0:0{ @p`?  J `TJ dH(0 !` (0`w `X`J P 2@zL0 `@!  @! @ z! @z> 0  J Pja  C 02[/0 GO00g`008 `&  & & 2[/J `TJ d`0y10`R0y10 `D 2{ @p` > !` 807``XS 2``M 0  ` / `/`/ ` T2 0 g9 / T2 0 Pg9 /T2 0 Pg9 /`2 `; @p`- C !` 00<``XL ``$(0`ؠ`d 80@ 2Z 2![D0, *@0@C0L0  ` @p `   X  X 2Z [g? `2 ` @p` 2!`3 80 h 2``L P2!P``2{!2P 2``Рr`, !`! !@10K0B h-  !  @h19 ! /2dZ[ `Bh hA@ @A T@0< @1ᨆK02 h/D020g"0; @p` !` 2D `. ``XJ (0``80 `` ؠ``uQ2 !hL T  Zg8 `J lTJ h2J20 ᰨ ; @p`  H80 !`6 80` `z `X`J P 2``|@_2@ozL0` .(`% ` !@   a@B a@ zICg20/c0J ᘫ@ `h(0`  %dJ R0b@C 00a (70dJ R0b@C >0/`(i`20ٻh C22aM"l0ʻ¾ ch @, \2 l T0ZR0 0c2 l  A0H{ A0Yr @P 0{`o!A0h` A0pW ` A0xL ` @ဎ/2 ʹAY3 62`R`J80` $R(`  d*`"l@ᔎ0/@0ԁPxOPqk`HCS0 d2! l L o `   l /` 2&0Dd   l b2 lJ 080d2`dQdT0R!P @Ḏ:/ l 2 dH 2` Qa a H l  d"l`dɹAY~ 2ܹ` l0O0g`b2P Jd0` lk/ɹAY[ 02ٹ``hJ CH0O0gR`:2@CVP Jd `T@OÄV OTC@NAVVٹJ1 ʹAY" ɹAY 2@" `/0/ 2`` J `20 0 z2@p``B»W0л``g `2 8 2h`$l dJ R0b@C  J R0bCdP` @ hj >0dJ R0b@C 70/@0"hQ $`c/ dJ R0b@C 00 000MaB J R0>0bdC570P`/ =0dJ R0b@C /0/ @` 0C l d$lC0qa(0; 0H80 SL ᴬd0` 0!0  4dd0lJ T `D0*0#l``  \a "\ l`:d l` CaC d#l P`` *0޻82``#l A@ᴬ RM@᪪᫪@ 2`JD"lDf0dd2 dd*0 bY d! d/#l$l /0g 2$2``#l/` $2` bx C C0Md$l`* 4 2D  <a1` 4 @0-`P`! @HE`d#l޹0@A᠑.`!22D (S&B ` b 0J $Κ^C TK  jP j а`@4P c02Q J $Ί^RҮRc2Q J $Ί^RRc2Q J $Ί^RCR20Q J $Ί^RRRJ 0J J `:`(` 80)0 * ( ` `` 0i 20L0AdG  T 0L0$dL t cJ*[W080dD0 0L0r0hH`c0I*[00D0 0\ D0J*[W0yd0D0E D0J 2`h` J 02H rHD dC0  D  D L0``L0 `0hJh@ᬓJ $ @ᴓx @8ZAd@ԓjJ $Q @ܓ] @8ZAdy@OJ $Α @B @8ZAd^LK ᴨ $ AdeJ ᴨblT`J*[W0yd0D0 D0.i HC`W0ދhH`4⪋hH`⨋J  (   J ` `J `J 0``xJ ᴨPPPPPaJ  A`$c1 0P!gfNa`0ㇹG0ALfW`J0@ @, @ @h л0`82(  J ĨZ0(  @ĨP2( A0s J ĨZP@CJ ᔫTL0`!d"㱑 L ᔫ P J@` ( @T`" AĨ" d;`( J ᔫ dJ ᔫ!nA`E!rAHPW0`g`6 `W0!nA`g"&`$` @* [80!nA>LPT0`S 0L00  (08 0D00$ S}Q  !T2``"l D0 d AO BQV P d lJ 0Α XC c c ` J 0RAP8 g/ 0)0h  ` 80kI 0Ή HCV` 0d    3  Z` oH0A Z`J 0 v  rJ 0P  cRR^ g@C5JP1` D cG' +L 0bP1`   b ` CP d jb801`P `!  cL 0  b C`P d  gK/ J 0c/ J 0  L 0'/N0!0㗶2 8R  8P}ST0@Cᴖ02@A἖&`2!2aH:0 lH!x2J ᜫafQ0ZT d 2`  3  P`8` 0@ lQJSC2Hᜫ DZT HCf H XC2 0gZHAC CIf D a G`/02kaPB0B0dC2` P`@CAP lfJJR0f@CK` 0 2)0@A4HĖ$H>Lga h Ha a H oaCg HXag Hag `aT `;g A`0g0 a ` *Z0=0(00P2 H*ZDK0x`T R 0 a" g0 ' @`a' `8 T2a鸈!b2 l$H 0 " g00 a#gg 2*Z dZ g  o0 a!g D0O0ad:P` 5 (O```U22 0 JF`{00u'dA0`; [0#dZ2I0!R7 *a 4 B` 5J` J +a QC  $ o! R` l{0'd #h{0 H'dB [0#d;00uA022dQC I0!R:W0dj``Oб`J @N4@<.@\(`2 `OP2`!2  J ᤬q0 cA? ` J ᠬa09d J ᜬ!2@጗E W" "@ᬗ @ės0fdc2`$ 0)`N @2 B@@&dd l@ `OP2$>  ܮ`pƀO& W0! TV!U0!0 !P`⭮x! !U T! J WB8!200:0J ᨬ0 ` , ; QL2al`J ᤬@P d@`L2am`J ᠬ@`OPAP da `O G) `OP pOP hOP` A (`OP pOP ChOP` QxOP`O `  `OP2PQBX0H)HQPX!@T Lc `h 0MJ ᜬ F9J ᤬@ 10ga :J ᠬ@`OFQ' W&T!W0!U0!0!0!U0a00 @0zN` c(! !U T! ! !U T` `b c`90gd2 2g200Z`  0d d2  @ @>R!F@< %@\ @᜘c @gdt2g [ 0' d l7 @`TH 010` g `cOP 2``2 O0D0g|P2UD0AOJVD0D0 = J ᠬ0 @0zkdll0g 2O0D0gIJ ZD02D0ZJVD0 @;c @ᴘL02/`L p`L0O`80 @0gJ pR ``Og0H!2:0~2 @OW0goAVB0`;00dg 00T01`J` 0J H J J 0H0I 0HJB 0`TTXOY`2OVV x0J 0HB`TTXOI`2OVVJ 0H2"lJ p\B8```````xI'@@2L `a@"[QD0`ba90`"2D0`d `JcLTJc T)`V!pV D0@e JJT!VT T伢D0'@@2L `a@"[QD0`ba騧0!"D0`d `JcJTJc /`T8V#pV D0 e JJT!VTVV伢D0J  2PpJJ `0 `"1` ` ``  ``d! H)``!@T `O @Hvc" `!J 0`J`  `"l"l"lJ P "l"l"l`2@YH 0Ic2` B0O0g` 2P Jd0` l0p@|@OVOOAVJV 0@OAV"l ` /`L n 2K QDZR`HBH@ᰙ hH@̙1 U ` @/J dӑZd0gJ h Q`VaB2` ^R` 0d /c0 00@n J PH` @{^ @ABM dJ PHK l2L  0^RB0㠬[B2`_Jd TJ T`PJ J 0J @AB dHJ` lҡ @0 @H`J` lJ nG0gN cX Ȱ+ @ᬬ`J  hJ ^D0D 2 h/H^\ а l\ `zJ J QJ @ QBlJ 0H `O! JJbo`J PHJ PHJ P(HBlP2cA ` 0APƁ`J  `"ll$@`Ⱘx80  @`㡨J 2Q <VJ  l`bo$880L \)020 X` $}Ƈ $wǁ $q'$m`!$h`" J `$J P(HBl~PP2 T @0zdu`2xOCOVV008 \Le (` $` $J W>8Cp00`0TC @dဓ`0x`H` @dဓ`8x80 \J $J 8P800`)020 2L @\? \L ` $Ƈ $ǁ $'$h 2ZPJ $ lC0)K`p 2L @p SD0"20090` G0g0T0000 dM2SQ_ 080  :g 70`\D 2L @ሚ) \Lf  O $Ƈ $ǁ $ '$7`hD02@<OVBOWO00g D0PO08gg8 @᠚ehF ƆGQ< J Z `OS00+ 8 !R29R:PZ2Z d l l0` `0OS08 `O QMQ@0z"d D0 2` J oB2H& I Pg `H J  JB$J  @$`:H% J g `H J  JB$J  $`*H*H aI $` J ao$"H0``$ `T Hc "H  d|`Hcc c J `$"l`o$ `L ` $㒦NQ`(d!T J  ff 8JB $2xJ 8Hcr J @H"l@`bl$`$@H I Pg$J  @H! p"lB$0g" o1 ! J  ?`AT@ J `J AH`!`JBV$@0!'*`80W08x 80ƁxCx`xG0g໘gz` xCx`xxG0gO c8W0d `2@CIC`x 80ƁxCx`xG0g໘gz xCx`xxG0g c8W0g `2@CIC`h80`w0`xo0`gxCg0 `xx0 c(pJ QT@OV OAATANVW@0ᴚ@i 0` cO"㮦J `cOㄢ $㌢ ㎟㒢200Rp80`O10P  `OP! 8`OP V 0wP^ 0wP004`:804yƅ00 4BBƆ!00@@@ƄYPHP @`OQƁP20@0@OBPJ0PVP 2  `$ a`@2J pIA(ZҬQZE=` B(E=` `0K@C 2g`Fp" @0P2Kb C0ѠJP"LLA(E=" @0P2b!РPJPC0"L3A(E=@К J ƪXO @c/ P T!@@/0N @8 RH L  L@T/`w `O L b@t 0堠 +@ማ~堠H@ᐛu堠H@ᤛl堠@H@ᴛc堠PH@ἛZL @ԛ!bN@L0eF`x10{`[ 2xaZ2[T2L2al'0ddZ cO og/C00 6A_㗟28 B P !T"@ 0Nac@ATZ2/.P @100 eQ @(`xP2cA*0`XT!7NPƠ 2z~A` _ "{0sPR EQQ&dcAXT!P`M02 a` @2J pZР2YaQZ[T 2d0dd=0Z b og/O0ag cb0F@HT7tS T1`U0Vs 80  a`@2J pY0ZРPd00@X 0% @d 0Jr @ @d/`0 2!0 c 0 A0_ݣ J 0Nc@U`e "ch K0@2I peAZРJ EQc@U_7N0BO `0000q2@ `6 "K0 @2K pZZȠ2bZZT!@ H0D0 ` 0NcPA/D0}P `dQ  `00!2"0G cI "ch K0@2I peAZРJ EQc@U_7N0ɝO`0000 0` "K0 @2I paZРP 0O@pRz`J@ p-@p-P`PB09{ 0` @dc0 q@zdcTqL p80D010*09z !`D0&eA| c `J R b`@ 2J pZѠP(02T!`  ! !@!$  d !b c !f l/!s ha/aJ dUc2```0 P25T QiadH` oO/]H 5H s SUH H s SMH H t T `C0 xJ R80 08Q@|08xJ R80 081@ᴜ082B  T W0a` g2@OVdD ` ` 290B     p @Al 2`P ddg@d2⼊ZB @Alth `PaA J bbB0 20y 0c`` = 2 @OVOAVOVmi@OVOAVOV Y|0Ge00" P@OVOAVOV @0" @Al@ 0P@A(40@OVOAVOHW@OVOAVOW[C }02 0*0 lPyaO0 PJ0ムB C0*[SK0D00ㆠ2`h[ &2 *ZZ` l0㻚gK0 l*ZZ`*[00L0( (0@AlH{@lL0" *ZC0ya| 0000K0 (0@AlHY@lK0R@AlH02"0`T` !2 @OVOAVOV@OVOAVOV @OVOAVOW*0 -,@OV.OAV/OV0 8QPC*D0Z2J T^RR` 546@OV7OVO0H0V P2` d54@OV6OAV7OV t 102@OVOV54@OV6OAV73OVO0@0VR 102@OVOV54@OV6OAV73OVO0@0V#0 102@OVOV54@OV6OAV73OVO0@0V @A(dRCEc dD 0 2 WB0_mB 2x 0d008Bm8J 20@C J APC0an `a㙘@ᄝ``ջ!ѹNu`T2J T d@Z᜝QջXP 2!@OV!L0B``r AOQV OV OQV A@@OVBCOAVOW`L0ar@OV0&! @OV"#OAVOW`L0agr @ᤝFYMP  dN AOVB  @OVOAVOHVf`12@ᬝ  @O8VƂAVÀHV^`1 @ԝb`" @O8VOVO@Vޠ@OVOAVOVdcTEQ3 !@OV)@OV0XHP"QQ c'd@T  W00!`g28 XGS %d @Al$ @0`[ Y @OV/=<@OV>?OAVO1W20@OV3OVO!Dt0`NPV|qYเdMP k/%$@OV&'OAVOWL0`Ae\q0!d .A+\C 2D `o *hZ*h`Z)T@Z`lPd? _0"!D P=2810``@2Zd102@OVO3VOQVP546@OVO7VOQVPdD K*h T[`𰠠0@"dJ TlSdl`Fx0A^"2 00L0 ` 85@Alᰞ 546@O*V7O[VO!D{0D0OPV|54@OV6OAV7OV2`[ 2```=S| p 2@OVOAVOV9e@OVOAVOV U8%`C "@AlRܢ@ 0DmPG@A(О0n;ܠ@OVOAVOHW @OVOAVOV8@OVOAVOW[C `CR`-2T 2 @OVOAVOV(6dD ya:`!0OP0:(0 @Al 0 0z @Al`90A28A "2 lPyaW0 (PJ0f``(89 K0*(S[D00d2`h [ &2 *(ZZ` l0㙕gK0 l*(ZZ`*([8L0: 8( ""*(ZC0yab 00( 8K0: 8@AlH8@lK0"9I9!:2 @OVOAVOV9@OVOAVOV 9L`: _0"(!DP 2 @OVOAVOV@OVOAVOVQ`  !D` 0dD  z*([K0D0Ae㒚2`O0"@ [ P`㝕 2%$@OV&OAV'OVP@OVx @OVOAVOV @OVOVOQV8`/W? `8!9O0W 2!09O00 8OQo  ]8OQ l QJ !08 D0 d9` 8d 8%%`T 0!d  ` !0  2J TT0^'2 d D/%g`T 0!d  ` !0  2J T^2[ a@@TAP2` 2 d DT0?;O@QLUQ PA(UP! l04-pa8 'a8 K)lyZA 0 d` 2 J`!l0xL~LO408`XE@I Wj0 4"00xHP 0H0 P2 `N@@N 00P ?JR4lx'"0 `h/20hg2ZoPDZBhlCP8K0AdD00d0 0Bsb2 2h^o lA!2h)0`` 0dJWA`@C` lJxCQC@I@Q d+0(2A`0dJS@C` lJXCQC@I!200`h 02d  2`c \2QD"Z bZPH0PK0ZRZDᬑ^ 2* 2Z* Zb0D0 80c  d/ V@d  GQ" % P 0D0T0`gJGT#` @gcAV d@ PdBQD0 0 00' 0 d g0dD0/Id@dHP(PC0HR` 2 d d  2`` `h !AZbAZZ P d  lh ^RB ^A⬊^ lSA lb ` 2 dPD"HZZR  2`b "``"`?* WZ*4Zں*Z*Z*Z *Z* :*ZJ* ZZ*Zj* Zz*LZ*Z*TZx:`9`l`B``iʻ88$ú%*TٻaoZ*QZ* ZB0r0{8`0M 3$ = `$8d89Q2:@OQ l`0:,8y8P80)P:9b88P8! ':)`0:8; Q)`02!`0L` l:(0 P+G0@f'G0 g%d" hU O0 P`"22ٸ@ ^^dd l* ZJ0 Ph`h * Zz0! B0OP2 A zhQ J^j^d lK hY50`2;L0080RSD2@44)Q^ڹd`DeZ4 2Z2 2Z2Zdg d l!l 22[l hQ 0`id2[ 09`aXd2[hq0D0G0@fE2DQ * Zz0! B0OP2 A {hY ^ڹ^d l4 hQ0`/20daD׹ i0*P2;Pg!l2d 2[l hQ0`2l 09`2Zl[hq0;G0 g* Zz;B0ZPU  V```?}p``@A`"!@@P"pI`!@P`9`!`@PB`A`hj !pQӽй````)`aڹaG0R@fG0 gQ00 `;= 8 5. C 8gGC C Y C7'i ` ƋR Cg0'g@A21@R'0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-&*''|9999&&(R**+|,D./<888803 4T44N5`67X7x7     ??@@@ @@@@xȃrȃȃă4ʅ<FT”|֕d| ܚ(;Zx0Nĥޤޤޤzppppppppppppf (2<FPZdnίx°ְ̰"&,2^bhlrv%K",6@&vlbXND:!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> u uz3v33444T4ȟПܟ|/-\mnJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat     PC: %08lx SEQSTAT: %08lx SP: %08lx R0: %08lx R1: %08lx R2: %08lx R3: %08lx R4: %08lx R5: %08lx R6: %08lx R7: %08lx P0: %08lx P1: %08lx P2: %08lx P3: %08lx P4: %08lx P5: %08lx FP: %08lx A0.w: %08lx A0.x: %08lx A1.w: %08lx A1.x: %08lx ?file errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkinvalid block typeinvalid stored block lengthstoo many length or distance symbolsoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeinvalid bit length repeatoversubscribed literal/length treeincomplete literal/length treeinvalid distance codeinvalid literal/length codeincorrect data check0.95Pstream endException! Exception: IRQ 0x%x entered code=[0x%x], stack frame=0x%x, bad PC=0x%04x Unhandled IRQ or exceptions! Please reset the board ### ERROR ### Please RESET the board ### FLASH: ethaddripaddrloadaddrbootfileNet: ADI BF537 EMAC I2C: ready baudrate%s (%s - %s) U-Boot 1.1.6-svn (ADI-2007R1-pre)Aug 31 200712:41:06%s Clock: VCO: %lu MHz, Core: %lu MHz, System: %lu MHz SDRAM: none%d%d.%d.%d.%d## Warning: gatewayip needed but not set bad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to netretrynoonce ARP Retry count exceeded; starting again gatewayipnetmaskvlannvlanserverip*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: `ethaddr' not set Abort Bytes transferred = %ld (%lx hex) %lxfilesize%lXfileaddrLoad address: 0x%lx Loading: *octettimeoutFile too largeFile has bad magic%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' TFTP from server ; our IP address is ; sending through gateway Filename '%s'. Size is 0x%x Bytes = Retry count exceeded; starting again T %lu MB received TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Starting again *** WARNING: %s is too long (%d - max: %d) - truncated BOOTP broadcast %d Host NameRoot PathNIS Domain NameautoloadNFSRARP broadcast %d Timeout /nfsroot/%02lX%02lX%02lX%02lX.imgFile transfer via NFS from server Filename '%s/%s'. Load address: 0x%lx Loading: **** ERROR: Cannot mount *** ERROR: Cannot umount *** ERROR: File lookup fail /*** ERROR: Symlink fail Error getting the date/time Error setting the date/time ## Command too long! ** Too many args (max. %d) ** Unknown command '%s' - try 'help' Usage: %s 'bootd' recursion detected ## Error: "%s" not defined %.*sbootretrybootdelaybootcmdHit any key to stop autoboot: %2d %2d srv1> Timed out waiting for command verifyBad magic number Bad header crc Bad data crc Bad image type Empty Script ## Executing script at %08lx autoscrautoscr - run script from memory [addr] - run script starting at addr - A valid autoscr header must be present %-12s= 0x%08lX boot_paramsmemstartmemsizeflashstartflashsizeflashoffsetethaddr =%c%02X ip_addr = baudrate = %d bps bdinfobdinfo - print Board Info structure ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gogo - start application at address 'addr' addr [arg ...] - start application at address 'addr' passing 'arg' as arguments resetreset - Perform RESET of the CPU ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... %xError: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d Image Name: %.*s Created: %4d-%02d-%02d %2d:%02d:%02d UTC Image Type: RTEMSUnknown OSInvalid OSNetBSDLinuxVxWorksQNXU-BootNios-IIUnknown ArchitectureInvalid CPUAlphaARMAVR32Intel x86IA64MIPSMIPS 64 BitPowerPCIBM S390SuperHSPARCSPARC 64 BitM68KMicroblazeBlackfinNiosFlat Device TreeUnknown ImageInvalid ImageStandalone ProgramKernel ImageRAMDisk ImageMulti-File ImageFirmwareScriptbzip2 compresseduncompressedgzip compressed%s %s %s (%s) Data Size: %d Bytes = Load Address: %08x Entry Point: %08x Contents: Image %d: %8ld Bytes = unknown compression ## Checking Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK ## Booting image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC Unsupported Architecture 0x%x Standalone ApplicationWrong Image Type for %s command XIP %s ... Uncompressing %s ... GUNZIP ERROR - must RESET board to recover Unimplemented compression type %d autostartCan't boot image type %d bootargsbootmbootm - boot application image from memory [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image boot - boot default, i.e., run 'bootcmd' bootdbootd - boot default, i.e., run 'bootcmd' iminfoiminfo - print header information for application image addr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums) imlsimls - list all images found in flash - Prints information about all images found at sector boundaries in flash. offONOFFData (writethrough) Cache is %s Instruction Cache is %s icacheicache - enable or disable instruction cache [on, off] - enable or disable instruction cache dcachedcache - enable or disable data cache [on, off] - enable or disable data (writethrough) cache List of available devices: %-8s %08x %c%c%c %s coninfoconinfo - print console devices and information Reset RTC... ## Bad date format unknown Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d SunMonTuesWednesThursFriSaturdatedate - get/set/reset date & time [MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTC read EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... done writeeepromeeprom - EEPROM sub-system read addr off cnt eeprom write addr off cnt - read/write `cnt' bytes at EEPROM offset `off' ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ClearLoad%sing %s @ 0x%08lx (%ld bytes) sh_addr: %08X, p_paddr: %08X Loading from: %08X to %08X, size: %d No load address provided tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddrNo bootargs defined ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... ## vxWorks terminated ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx bootelfbootelf - Boot from an ELF image in memory [address] - load address of ELF image. bootvxbootvx - Boot vxWorks from an ELF image [address] - load address of vxWorks ELF image. %sProtect Flash Sectors %d-%d in Bank # %d bankBad address format Error: start and/or end address not on sector boundary Only FLASH Banks # 1 ... # %d supported Error: end address (0x%08lx) not in flash! allBad sector specification Un-Erase Flash Sectors %d-%d in Bank # %d flinfoflinfo - print FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # N eraseerase - erase FLASH memory start end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banks protectprotect - enable or disable FLASH write protection on start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writable Error reading the chip. Valid chip addresses: %02X%04x: %02x .%cCRC32 for %08lx ... %08lx ==> Error reading the chip, Error writing the chip. %08lx: Error reading the chip, %02lx %04lx %08lx ? imdimd - i2c memory display chip address[.0, .1, .2] [# of objects] - i2c memory display immimm - i2c memory modify (auto-incrementing) chip address[.0, .1, .2] - memory modify, auto increment address inminm - memory modify (constant address) chip address[.0, .1, .2] - memory modify, read and keep address imwimw - memory write (fill) chip address[.0, .1, .2] value [count] - memory write (fill) icrc32icrc32 - checksum calculation chip address[.0, .1, .2] count - compute CRC32 checksum iprobeiprobe - probe to discover valid I2C chip addresses -discover valid I2C chip addresses iloopiloop - infinite loop on address range chip address[.0, .1, .2] [# of objects] - loop, reading a set of addresses Unknown operator '%s' Invalid data width specifier -lt<-gt>-eq==-ne!=<>-ge>=-le<=itestitest - return true/false on integer compare [.b, .w, .l, .s] [*]value1 [*]value2 nandnorinvalid partition number %d for device %s%d (%s) incorrect device type in %s incorrect device number in %s out of memory single partnor0no such FLASH device: %s%d (valid range 0 ... %d support for NAND devices not present incorrect device: %s%d CRAMFSJFFS2### filesystem type is % 2s uImage### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx ### %s LOAD ERROR<%x> for %s! fsloadfsload - load binary file from a filesystem image [ off ] [ filename ] - load binary file from flash bank with offset 'off' lsls - list files in a directory (default /) [ directory ] - list files in a directory. fsinfofsinfo - print information about filesystems - print information about filesystems ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Total Size = 0x%08x = %d Bytes %X## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... loads_echo## Ready for S-Record download ... ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes ## S-Record download aborted loadsloads - load S-Record file over serial line [ off ] - load S-Record file over serial line with offset 'off' loadbloadb - load binary file over serial line (kermit mode) [ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud' loady - load binary file over serial line (ymodem mode) Reading... Mem error @ 0x%08X: found %08lX, expected %08lX Base Address: 0x%08lx CRC32 for %08lx ... %08lx ==> %08lx Pattern %08lX Writing...%12s %08x %04xZero length ??? Copy to Flash... word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) halfwordbyteTotal of %ld %s%s were the same mdmd - memory display [.b, .w, .l] address [# of objects] - memory display mmmm - memory modify (auto-incrementing) [.b, .w, .l] address - memory modify, auto increment address nmnm - memory modify (constant address) [.b, .w, .l] address - memory modify, read and keep address mwmw - memory write (fill) [.b, .w, .l] address value [count] - write memory cpcp - memory copy [.b, .w, .l] source target count - copy memory cmpcmp - memory compare [.b, .w, .l] addr1 addr2 count - compare memory crc32crc32 - checksum calculation address count [addr] - compute CRC32 checksum [save at addr] basebase - print or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off' looploop - infinite loop on address range [.b, .w, .l] address number_of_objects - loop on a set of addresses mtestmtest - simple RAM test [start [end [pattern]]] - simple RAM read/write test sleepsleep - delay execution for some time N - delay execution for N seconds (N is _decimal_ !!!) ping failed; host %s is not alive host %s is alive hostnamerootpathdnsipdomainyesAutomatic boot of image at addr 0x%08lX ... bootpbootp - boot image via network using BootP/TFTP protocol [loadAddress] [bootfilename] tftpboottftpboot- boot image via network using TFTP protocol rarpbootrarpboot- boot image via network using RARP/TFTP protocol nfsnfs - boot image via network using NFS protocol [loadAddress] [host ip addr:bootfilename] pingping - send ICMP ECHO_REQUEST to network host pingAddress Saving Environment to %s... ## Error: illegal character '=' in variable name "%s" serial#Can't overwrite "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted setenv ** Abort Environment size: %d/%d bytes printenvprintenv- print environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name' setenv - set environment variables name value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name' saveenvsaveenv - save environment variables to persistent storage runrun - run commands in an environment variable var [...] - run the commands in the environment variable(s) 'var' - No help available. Unknown command '%s' - try 'help' without arguments for list of all known commands %s versionversion - print monitor version echoecho - echo args to console [args..] - echo args to console; \c suppresses newline helphelp - print online help [command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments. ? - alias for 'help' In: No input devices available! Out: No output devices available! Err: No error devices available! Cannot initialize the list of devices! serial*** Warning - bad CRC, using default environment EEPROMTimeout writing to Flash Flash not Erased Can't write to protected Flash sectors Outside available Flash Start and/or end address not on sector boundary Unknown Vendor of Flash Unknown Type of Flash General Flash Programming Error %s[%d] FIXME: rc=%d flash.cBlock sequence errorUnknown errorCan't access fileSorry, zModem not available yetTimed outEnd of fileCancelledInvalid framingCRC/checksum errorCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries %2ld.%ld %cB%s %s 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzCPU: ADSP BF537 Rev.: 0.%d Board: ADI BF537 stamp board Support: http://blackfin.uclinux.org/ missing or unknown FLASH type ST Microelectronics Unknown Vendor: (0x%08X) (RO) %08lX%s- Warning: %d protected sectors will not be erased! Erasing flash, Please Wait Erasing flash failed Erasing Flash locations, Please Wait Error Sector erasing Flash not erased at offset 0x%x Please erase to reprogram Error programming the flash ## Unknown FLASH on Bank 0 - Size = 0x%08lx = %ld MB Link is down, please check your network connection Using MAC Address %02X:%02X:%02X:%02X:%02X:%02X Ethernet: rx dma overrun Ethernet: rx error Ethernet: bad frame Ethernet: bad packet size: %d Ethernet: tx DMA error Ethernet: tx time out Ethernet: tx error SPI Write Time Out SPI Program Time out! SPI Erase block error Invalid sector! Starting Kernel at = %x cramfs: wrong magic cramfs: unsupported filesystem features cramfs: root is not a directory cramfs: empty filesystemcramfs: bad root offset %lu size: 0x%x (%u) flags: FSID version 2 sorted dirs holes shifted root offset fsid: crc: 0x%x edition: 0x%x name: %16s %*.*s: unsupported file type (%x) can't find corresponding entry %s %8d %*.*s -> %*.*s [Error reading link] get_node_mem: unknown device type, using raw offset! get_fl_mem: unknown device type, using raw offset! add_node: malloc failed add_node failed! ** ERROR ** %s %08x has dup version =find_inode failed for name=UNKOWN COMPRESSION METHOD = Scanning JFFS2 FS: %c . OOPS Cleanmarker has bad size %d != %d OOPS Padding has bad size %d < %d Unknown node type: %x len %d offset 0x%x  done. %s: Failed to scan JFFSv2 file structure infoCompression: %s frag count: %d compressed sum: %d uncompressed sum: %d load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure load: Failed to read inode %.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> ls: Failed to scan jffs2 file structure NONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIBxwr%K  $$,,44<<DDLLTT\\ddlltt||ĠĠ̠̠ԠԠܠܠ  $$,,44<<DDLLTT\\ddlltt||ġġ̡̡ԡԡܡܡ  $$,,44<<DDLLTT\\ddlltt||ĢĢ̢̢ԢԢܢܢ  $$,,44<<DDLLTT\\ddlltt||ģģ̣̣ԣԣܣܣXXVVVVV #+3;CScs !1Aa  0@` @@@@ @@@@  0@P`p 0@P`p@nnnnnnn(~,~0~4~8~<~@~D~H~L~P~T~X~@hpxbootargs=root=/dev/mtdblock0 rwbootcmd=run rambootbootdelay=5baudrate=115200loads_echo=1ipaddr=192.168.0.15serverip=192.168.0.2autoload=norootpath=/romfsgatewayip=192.168.0.1netmask=255.255.255.0hostname=BF537ramargs=setenv bootargs root=/dev/mtdblock0 rwnfsargs=setenv bootargs root=/dev/nfs rw nfsroot=$(serverip):$(rootpath)addip=setenv bootargs $(bootargs) ip=$(ipaddr):$(serverip):$(gatewayip):$(netmask):$(hostname):eth0:offramboot=tftpboot 0x1000000 linux;run ramargs;run addip;bootelfnfsboot=tftpboot 0x1000000 linux;run nfsargs;run addip;bootelfflashboot= eeprom read 0x1000000 0x20000 0x100000;bootelf 0x1000000update=tftpboot 0x1000000 u-boot.ldr;eeprom write 0x1000000 0x0 $(filesize);@(((((AAAAAABBBBBBG  1aaabXbLc4Pcccxjci(ijjjj k(kdk